Tessa 5mg
Research Use Only
DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of usage.
Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.
What is this product?
Engineered for rigorous scientific inquiry, this peptide is provided in a lyophilized format to preserve structural integrity during transit and storage. Our products are intended for investigational use only and is not suitable for human or animal consumption. Detailed Certificates of Analysis (CoA) are available to support experimental reproducibility and confirm molecular weight and purity.
Form: Lyophilized powder
Unit size: 10mg/vial
Unit quantity: 1 vial
Molecular formula: C223H370N72O69S
Molecular weight: 5196 g/mol
Synonym: Tesamorelin acetate
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
CAS number: 901758-09-6